Skip to content
Open
Show file tree
Hide file tree
Changes from all commits
Commits
File filter

Filter by extension

Filter by extension

Conversations
Failed to load comments.
Loading
Jump to
Jump to file
Failed to load files.
Loading
Diff view
Diff view
396 changes: 396 additions & 0 deletions CodonTransformer/CodonComplexity.py
Original file line number Diff line number Diff line change
@@ -0,0 +1,396 @@
"""
File: CodonComplexity.py
------------------------
Includes functions for checking DNA sequence complexity and enforcing synthesis rules.
"""

from typing import Dict, List, Optional, Tuple, Union
import re
from dataclasses import dataclass

from CodonTransformer.CodonUtils import DNASequencePrediction

def calculate_gc_content(sequence: str) -> float:
"""Calculate the GC content of a DNA sequence.

Args:
sequence (str): The DNA sequence

Returns:
float: GC content as a percentage
"""
if not sequence:
return 0.0
gc_count = sequence.count('G') + sequence.count('g') + sequence.count('C') + sequence.count('c')
return (gc_count / len(sequence)) * 100

@dataclass
class ComplexityViolation:
"""Represents a violation of sequence complexity rules."""
rule_name: str
description: str
severity: float # Score contribution to total complexity
suggestion: str
location: Optional[Tuple[int, int]] = None # Start and end positions if applicable

@dataclass
class ComplexityConfig:
"""Configuration for sequence complexity checking."""
max_repeat_length: int = 20 # Maximum length of repeats
min_repeat_tm: float = 60.0 # Minimum melting temperature for repeat check
min_gc_content: float = 25.0 # Minimum global GC content
max_gc_content: float = 65.0 # Maximum global GC content
max_gc_deviation: float = 52.0 # Maximum deviation in GC content within gene
gc_window_size: int = 50 # Window size for GC content calculation
max_homopolymer_length: int = 5 # Maximum length of homopolymer runs
his_tag_pattern: str = "CACCAC" # Required pattern for HIS tags
enabled_rules: List[str] = None # List of rules to check, None means all

def __post_init__(self):
if self.enabled_rules is None:
self.enabled_rules = [
"repeat_sequences",
"gc_content",
"gc_deviation",
"homopolymers",
"his_tag"
]

def calculate_tm(sequence: str) -> float:
"""
Calculate the melting temperature of a DNA sequence.
Uses a basic nearest-neighbor method.

Args:
sequence (str): DNA sequence

Returns:
float: Estimated melting temperature in Celsius
"""
if len(sequence) < 2:
return 0.0

# Basic nearest-neighbor parameters (simplified)
nn_params = {
'AA': -7.9, 'TT': -7.9,
'AT': -7.2, 'TA': -7.2,
'CA': -8.5, 'TG': -8.5,
'GT': -8.4, 'AC': -8.4,
'CT': -7.8, 'AG': -7.8,
'GA': -8.2, 'TC': -8.2,
'CG': -10.6, 'GC': -9.8,
'GG': -8.0, 'CC': -8.0
}

# Calculate entropy contribution
dH = sum(nn_params.get(sequence[i:i+2], 0) for i in range(len(sequence)-1))

# Add initiation parameters
dH += 0.1 * len(sequence)

# Approximate Tm calculation
return round((dH * 1000) / (len(sequence) * -10 + 108), 1)

def find_repeats(sequence: str, min_length: int = 20, min_tm: float = 60.0) -> List[Tuple[str, List[int]]]:
Copy link
Copy Markdown

Choose a reason for hiding this comment

The reason will be displayed to describe this comment to others. Learn more.

find_repeats is not providing a set() of the repeats (i.e. there are duplicates in the output). This method is also slow due to .get for each nt pair. It would be faster to precompute the neighbor dH into an array and using a fast cumulative‑sum lookup. The below suggestion is much faster (~20X), provides a unique set of repeats, and also calculates tm within find_repeats.

NN_PARAMS = {
    'AA': -7.9, 'TT': -7.9,
    'AT': -7.2, 'TA': -7.2,
    'CA': -8.5, 'TG': -8.5,
    'GT': -8.4, 'AC': -8.4,
    'CT': -7.8, 'AG': -7.8,
    'GA': -8.2, 'TC': -8.2,
    'CG': -10.6, 'GC': -9.8,
    'GG': -8.0, 'CC': -8.0
}

def find_repeats(
    sequence: str,
    min_length: int = 20,
    min_tm: float = 60.0,
    max_length: int = 50
) -> List[Tuple[str, List[int]]]:
    seq = sequence.upper()
    n = len(seq)
    if n < min_length:
        return []

    # Precompute neighbor ΔH cumsum
    dh_arr = np.array([NN_PARAMS.get(seq[i:i+2], 0.0) 
                       for i in range(n-1)], dtype=float)
    cs = np.concatenate(([0.0], np.cumsum(dh_arr)))

    repeats = {}
    for L in range(min_length, min(max_length, n)+1):
        denom = L * -10.0 + 108.0

        for i in range(n - L + 1):
            # sum ΔH + initiation
            window_dh = (cs[i+L-1] - cs[i]) + 0.1*L
            tm = (window_dh * 1000.0) / denom
            if tm < min_tm:
                continue

            pat = seq[i:i+L]
            # find all start positions
            pos, start = [], 0
            while True:
                idx = seq.find(pat, start)
                if idx < 0: break
                pos.append(idx)
                start = idx+1

            if len(pos) > 1:
                repeats[pat] = pos

    return list(repeats.items())

"""
Find repeated sequences in DNA that meet length and Tm criteria.

Args:
sequence (str): DNA sequence
min_length (int): Minimum length of repeats to find
min_tm (float): Minimum melting temperature threshold

Returns:
List[Tuple[str, List[int]]]: List of (repeat sequence, positions) tuples
"""
repeats = []
sequence = sequence.upper()

# Look for repeats of various lengths
for length in range(min_length, min(50, len(sequence))):
for i in range(len(sequence) - length + 1):
pattern = sequence[i:i+length]
if calculate_tm(pattern) >= min_tm:
# Find all occurrences
positions = [m.start() for m in re.finditer(f'(?={pattern})', sequence)]
if len(positions) > 1:
repeats.append((pattern, positions))

return repeats

def calculate_gc_windows(sequence: str, window_size: int = 50) -> List[float]:
"""
Calculate GC content in sliding windows.

Args:
sequence (str): DNA sequence
window_size (int): Size of sliding window

Returns:
List[float]: List of GC percentages for each window
"""
gc_contents = []
for i in range(0, len(sequence) - window_size + 1):
window = sequence[i:i+window_size]
gc_contents.append(calculate_gc_content(window))
return gc_contents

def find_homopolymers(sequence: str, max_length: int = 5) -> List[Tuple[str, int]]:
"""
Find homopolymer runs longer than specified length.

Args:
sequence (str): DNA sequence
max_length (int): Maximum allowed homopolymer length

Returns:
List[Tuple[str, int]]: List of (homopolymer sequence, position) tuples
"""
homopolymers = []
for match in re.finditer(r'([ATCG])\1{' + str(max_length) + ',}', sequence):
homopolymers.append((match.group(), match.start()))
return homopolymers

def check_sequence_complexity(
sequence: str,
config: Optional[ComplexityConfig] = None
) -> List[ComplexityViolation]:
"""
Check DNA sequence against complexity rules.

Args:
sequence (str): DNA sequence to check
config (Optional[ComplexityConfig]): Configuration for complexity checking

Returns:
List[ComplexityViolation]: List of complexity rule violations
"""
if config is None:
config = ComplexityConfig()

violations = []
sequence = sequence.upper()

# Check repeat sequences
if "repeat_sequences" in config.enabled_rules:
repeats = find_repeats(sequence, config.max_repeat_length, config.min_repeat_tm)
if repeats:
repeat_percentage = sum(len(r[0]) * len(r[1]) for r in repeats) / len(sequence) * 100
Copy link
Copy Markdown

Choose a reason for hiding this comment

The reason will be displayed to describe this comment to others. Learn more.

This method seems to provide % coverage > 100% (particularly since find_repeats does not return a unique set of repeats.

Suggestion to add function for proper sequence coverage, such as:

def repeat_coverage_pct_by_set(repeats, seq_len):
    """
    repeats : List[Tuple[str, List[int]]]  
    seq_len : int
    returns percent of bases covered by at least one repeat
    """
    covered = set()
    for pat, poses in repeats:
        L = len(pat)
        for p in poses:
            covered.update(range(p, p + L))
    return len(covered) / seq_len * 100.0

if repeat_percentage > 40:
violations.append(ComplexityViolation(
rule_name="repeat_sequences",
description=f"Repeated sequences comprise {repeat_percentage:.1f}% of sequence",
severity=8.8 if repeat_percentage > 60 else 4.4,
suggestion="Redesign to reduce repeats to less than 40% of sequence"
))

# Check global GC content
if "gc_content" in config.enabled_rules:
gc_content = calculate_gc_content(sequence)
if not config.min_gc_content <= gc_content <= config.max_gc_content:
violations.append(ComplexityViolation(
rule_name="gc_content",
description=f"Global GC content ({gc_content:.1f}%) outside allowed range",
severity=4.2,
suggestion=f"Adjust sequence to have GC content between {config.min_gc_content}% and {config.max_gc_content}%"
))

# Check GC content deviation
if "gc_deviation" in config.enabled_rules:
gc_windows = calculate_gc_windows(sequence, config.gc_window_size)
if gc_windows:
max_gc = max(gc_windows)
min_gc = min(gc_windows)
gc_deviation = max_gc - min_gc
if gc_deviation > config.max_gc_deviation:
max_gc_pos = gc_windows.index(max_gc) * config.gc_window_size
violations.append(ComplexityViolation(
rule_name="gc_deviation",
description=f"GC content deviation ({gc_deviation:.1f}%) exceeds maximum",
severity=4.0,
suggestion="Reduce GC content variation between regions",
location=(max_gc_pos, max_gc_pos + config.gc_window_size)
))

# Check homopolymers
if "homopolymers" in config.enabled_rules:
homopolymers = find_homopolymers(sequence, config.max_homopolymer_length)
if homopolymers:
violations.append(ComplexityViolation(
rule_name="homopolymers",
description=f"Contains {len(homopolymers)} long homopolymer runs",
severity=1.0,
suggestion="Break up long runs of identical nucleotides"
))

# Check HIS tag pattern if present
if "his_tag" in config.enabled_rules and "CAC" in sequence:
his_pattern = re.compile(r'(CAC){2,}')
if not his_pattern.search(sequence):
violations.append(ComplexityViolation(
rule_name="his_tag",
description="Incorrect HIS tag pattern",
severity=0.5,
suggestion="Use alternating CAC/CAT codons for HIS tags"
))

return violations

def get_total_complexity_score(violations: List[ComplexityViolation]) -> float:
"""
Calculate total complexity score from violations.

Args:
violations (List[ComplexityViolation]): List of complexity violations

Returns:
float: Total complexity score
"""
return sum(v.severity for v in violations)

def predict_with_complexity_check(
predict_func,
protein: str,
organism: Union[int, str],
complexity_config: Optional[ComplexityConfig] = None,
max_attempts: int = 10,
**kwargs
) -> Tuple[DNASequencePrediction, Optional[str]]:
"""
Wrapper for DNA sequence prediction that checks sequence complexity.

Args:
predict_func: Function that predicts DNA sequences
protein (str): Input protein sequence
organism (Union[int, str]): Organism ID or name
complexity_config (Optional[ComplexityConfig]): Configuration for complexity checking
max_attempts (int): Maximum number of prediction attempts
**kwargs: Additional arguments for predict_func

Returns:
Tuple[DNASequencePrediction, Optional[str]]:
- The predicted sequence (best one if multiple attempts)
- Complexity report for the sequence
"""
best_prediction = None
best_score = float('inf')
best_report = None

# Try generating sequences until we find one that passes complexity checks
# or reach max attempts
for attempt in range(max_attempts):
# Get a new prediction
if kwargs.get('deterministic', True):
kwargs['deterministic'] = False
kwargs['temperature'] = 0.2 + (attempt * 0.1) # Gradually increase temperature

prediction = predict_func(protein=protein, organism=organism, **kwargs)

# Check sequence complexity
violations = check_sequence_complexity(
prediction.predicted_dna,
config=complexity_config
)
score = get_total_complexity_score(violations)

# Generate report
report = format_complexity_report(prediction.predicted_dna, violations)

# Keep track of best sequence seen
if score < best_score:
best_prediction = prediction
best_score = score
best_report = report

# If this sequence passes complexity checks, return it
if score < 10:
return prediction, report

# If we couldn't find a sequence that passes checks, return best one seen
return best_prediction, best_report

def format_complexity_report(
sequence: str,
violations: List[ComplexityViolation]
) -> str:
"""
Format complexity check results into a readable report.

Args:
sequence (str): The analyzed DNA sequence
violations (List[ComplexityViolation]): List of found violations

Returns:
str: Formatted report string
"""
total_score = get_total_complexity_score(violations)

report = []
report.append("DNA Sequence Complexity Analysis")
report.append("=" * 40)
report.append(f"Sequence Length: {len(sequence)} bp")
report.append(f"Total Complexity Score: {total_score:.1f}")

if total_score >= 10:
report.append("\nWARNING: Sequence may be too complex for synthesis")

if violations:
report.append("\nComplexity Issues Found:")
for v in violations:
report.append(f"\n{v.rule_name}:")
report.append(f" Description: {v.description}")
report.append(f" Severity Score: {v.severity}")
report.append(f" Suggestion: {v.suggestion}")
if v.location:
report.append(f" Location: {v.location[0]}-{v.location[1]}")
else:
report.append("\nNo complexity issues found.")

return "\n".join(report)
"""
# Usage example
if __name__ == "__main__":
from CodonTransformer.CodonPrediction import predict_dna_sequence
import torch

# Example protein sequence
protein = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLA"
organism = "Escherichia coli general"

# Set up custom complexity rules
config = ComplexityConfig(
max_repeat_length=18, # More stringent repeat check
max_gc_content=60.0, # Lower max GC content
max_gc_deviation=45.0, # More stringent GC deviation check
max_homopolymer_length=4, # Stricter homopolymer limit
enabled_rules=[ # Only check these specific rules
"repeat_sequences",
"gc_content",
"gc_deviation",
"homopolymers"
]
)

# Set up device and model
device = torch.device("cuda" if torch.cuda.is_available() else "cpu")

# Initialize prediction with complexity checking
prediction, complexity_report = predict_with_complexity_check(
predict_func=predict_dna_sequence,
protein=protein,
organism=organism,
complexity_config=config,
device=device,
deterministic=False, # Use non-deterministic mode for multiple attempts
temperature=0.2, # Start with conservative sampling
top_p=0.95, # Use nucleus sampling
max_attempts=5 # Try up to 5 times to get a good sequence
)

# Print results
print("===== Sequence Generation Results =====")
print("\nPredicted DNA sequence:")
print(prediction.predicted_dna)
print("\nComplexity Analysis:")
print(complexity_report)
"""
Loading